Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Vascular endothelial growth factor D

Product Specifications

CAS Number

9000-83-3

Gene Name

Vascular endothelial growth factor D

Gene Aliases

C-fos induced growth factor (vascular endothelial growth factor D) ; c-Fos-induced growth factor; FIGF; vascular endothelial growth factor D; VEGF-D.

Gene ID

2277

Reactivity

Homo sapiens|Human

Target

Growth factor active in angiogenesis, lymphangiogenesis and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in the formation of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors.

Type

Protein

Source

E.coli

Sequence

FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

VEGFD

Protein Name

Vascular endothelial growth factor D

Gene Name URL

VEGFD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRSF11 ORF Vector (Human) (pORF)
45514011 1.0 µg DNA

SRSF11 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Rabbit Polyclonal PDK4 Antibody [DyLight 550]
NBP1-07047R 0.1 mL

Rabbit Polyclonal PDK4 Antibody [DyLight 550]

Sign In for Pricing
View Details
2,4-Dichloroaniline
10099643-100g 100 g

2,4-Dichloroaniline

Sign In for Pricing
View Details
Olr1194 Protein Vector (Rat) (pPM-C-His)
PV287349 500 ng

Olr1194 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Olr742 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV628114 1.0 µg DNA

Olr742 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
GLP-1R agonist 20
orb3134221-01 50 mg

GLP-1R agonist 20

Sign In for Pricing
View Details