Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Vascular endothelial growth factor D

Product Specifications

CAS Number

9000-83-3

Gene Name

Vascular endothelial growth factor D

Gene Aliases

C-fos induced growth factor (vascular endothelial growth factor D) ; c-Fos-induced growth factor; FIGF; vascular endothelial growth factor D; VEGF-D.

Gene ID

2277

Reactivity

Homo sapiens|Human

Target

Growth factor active in angiogenesis, lymphangiogenesis and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in the formation of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors.

Type

Protein

Source

E.coli

Sequence

FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

VEGFD

Protein Name

Vascular endothelial growth factor D

Gene Name URL

VEGFD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRDX3P3 Protein Vector (Human) (pPB-N-His)
PV113127 500 ng

PRDX3P3 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Chicken MUC5B/Mucin-5B ELISA Kit
E0055Ch 96 Tests

Chicken MUC5B/Mucin-5B ELISA Kit

Sign In for Pricing
View Details
Amyloid Fibrils (OC) Antibody (ATTO 700)
abx448349 100 µL

Amyloid Fibrils (OC) Antibody (ATTO 700)

Sign In for Pricing
View Details
Rabbit Anti CSNK2A1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA) 120ul
IRBAMLCSNK2A1AP001120UL 120 µL

Rabbit Anti CSNK2A1 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA) 120ul

Sign In for Pricing
View Details
KLF4 Rabbit Polyclonal Antibody (Biotin)
orb457496 100 µL

KLF4 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Mouse Monoclonal MTBP Antibody (2C1E11) [Alexa Fluor 594]
NBP2-50517AF594 0.1 mL

Mouse Monoclonal MTBP Antibody (2C1E11) [Alexa Fluor 594]

Sign In for Pricing
View Details