Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNCA Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Synuclein alpha

Gene Aliases

Alpha-synuclein; I+/--synuclein; NACP; non A-beta component of AD amyloid; Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; PARK1; PARK4; PD1; synuclein alpha-140; synuclein, alpha (non A4 component of amyloid precursor) ; truncated alpha synuclein.

Gene ID

6622

Reactivity

Homo sapiens|Human

Target

May be involved in the regulation of dopamine release and transport. Induces fibrillization of microtubule-associated protein tau. Reduces neuronal responsiveness to various apoptotic stimuli, leading to a decreased caspase-3 activation.

Type

Protein

Source

E.coli

Sequence

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

41.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SNCA

Protein Name

Alpha-synuclein

Gene Name URL

SNCA

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMTC1 antibody
70R-7426 100 µL

TMTC1 antibody

Sign In for Pricing
View Details
Rabbit anti-Calpain-15 Antibody, Affinity Purified
A304-058A 100 µg

Rabbit anti-Calpain-15 Antibody, Affinity Purified

Sign In for Pricing
View Details
Ncor1 (NM_177229) Mouse Tagged ORF Clone
MR229044 10 µg

Ncor1 (NM_177229) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal Exendin-4 Antibody (24) [DyLight 405]
NBP2-23579V 0.1 mL

Mouse Monoclonal Exendin-4 Antibody (24) [DyLight 405]

Sign In for Pricing
View Details
Mouse Phf24 qPCR Primer Pair
QM59126S 200 Tests

Mouse Phf24 qPCR Primer Pair

Sign In for Pricing
View Details
F8 (Coagulation Factor VIII, Factor VIII, Antihemophilic Factor, AHF, F8B, F8C, HEMA, FVIII, DXS1253E) (MaxLight 490)
MBS6416635-01 0.1 mL

F8 (Coagulation Factor VIII, Factor VIII, Antihemophilic Factor, AHF, F8B, F8C, HEMA, FVIII, DXS1253E) (MaxLight 490)

Sign In for Pricing
View Details