Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Leptin

Product Specifications

CAS Number

9000-83-3

Gene Name

Leptin

Gene Aliases

LEPD; leptin; leptin (murine obesity homolog) ; leptin (obesity homolog, mouse) ; OB; obese protein; obese, mouse, homolog of; obesity factor; OBS.

Gene ID

3952

Reactivity

Homo sapiens|Human

Target

Key player in the regulation of energy balance and body weight control. Once released into the circulation, has central and peripheral effects by binding LEPR, found in many tissues, which results in the activation of several major signaling pathways (PubMed:17344214, PubMed:15899045, PubMed:19688109) . In the hypothalamus, acts as an appetite-regulating factor that induces a decrease in food intake and an increase in energy consumption by inducing anorexinogenic factors and suppressing orexigenic neuropeptides, also regulates bone mass and secretion of hypothalamo-pituitary-adrenal hormones. In the periphery, increases basal metabolism, influences reproductive function, regulates pancreatic beta-cell function and insulin secretion, is pro-angiogenic for endothelial cell and affects innate and adaptive immunity (By similarity) (PubMed:8589726, PubMed:11460888, PubMed:19688109, PubMed:24340098, PubMed:25060689) . In the arcuate nucleus of the hypothalamus, activates by depolarization POMC neurons inducing FOS and SOCS3 expression to release anorexigenic peptides and inhibits by hyperpolarization NPY neurons inducing SOCS3 with a consequent reduction on release of orexigenic peptides (By similarity) . In addition to its known satiety inducing effect, has a modulatory role in nutrient absorption. In the intestine, reduces glucose absorption by enterocytes by activating PKC and leading to a sequential activation of p38, PI3K and ERK signaling pathways which exerts an inhibitory effect on glucose absorption (PubMed:24340098) . Acts as a growth factor on certain tissues, through the activation of different signaling pathways increases expression of genes involved in cell cycle regulation such as CCND1, via JAK2-STAT3 pathway, or VEGFA, via MAPK1/3 and PI3K-AKT1 pathways (By similarity) (PubMed:17344214) . May also play an apoptotic role via JAK2-STAT3 pathway and up-regulation of BIRC5 expression (PubMed:18242580) . Pro-angiogenic, has mitogenic activity on vascular endothelial cells and plays a role in matrix remodeling by regulating the expression of matrix metalloproteinases (MMPs) and tissue inhibitors of metalloproteinases (TIMPs) (PubMed:11460888) . In innate immunity, modulates the activity and function of neutrophils by increasing chemotaxis and the secretion of oxygen radicals. Increases phagocytosis by macrophages and enhances secretion of pro-inflammatory mediators. Increases cytotoxic ability of NK cells (PubMed:12504075) . Plays a pro-inflammatory role, in synergy with IL1B, by inducing NOS2 wich promotes the production of IL6, IL8 and Prostaglandin E2, through a signaling pathway that involves JAK2, PI3K, MAP2K1/MEK1 and MAPK14/p38 (PubMed:15899045, PubMed:19688109) . In adaptive immunity, promotes the switch of memory T-cells towards T helper-1 cell immune responses (By similarity) . Increases CD4 (+) CD25 (-) T-cell proliferation and reduces autophagy during TCR (T-cell receptor) stimulation, through MTOR signaling pathway activation and BCL2 up-regulation (PubMed:25060689) .

Type

Protein

Source

E.coli

Sequence

DDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

19 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LEP

Protein Name

Leptin

Gene Name URL

LEP

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Leptospira biflexa serovar Patoc Spermidine synthase (speE)
MBS1112352-01 0.02 mg (E-Coli)

Recombinant Leptospira biflexa serovar Patoc Spermidine synthase (speE)

Ask
View Details
Recombinant Leptospira biflexa serovar Patoc Spermidine synthase (speE)
MBS1112352-02 0.02 mg (Yeast)

Recombinant Leptospira biflexa serovar Patoc Spermidine synthase (speE)

Ask
View Details
Recombinant Leptospira biflexa serovar Patoc Spermidine synthase (speE)
MBS1112352-03 0.1 mg (E-Coli)

Recombinant Leptospira biflexa serovar Patoc Spermidine synthase (speE)

Ask
View Details
Recombinant Leptospira biflexa serovar Patoc Spermidine synthase (speE)
MBS1112352-04 0.1 mg (Yeast)

Recombinant Leptospira biflexa serovar Patoc Spermidine synthase (speE)

Ask
View Details
Recombinant Leptospira biflexa serovar Patoc Spermidine synthase (speE)
MBS1112352-05 0.02 mg (Baculovirus)

Recombinant Leptospira biflexa serovar Patoc Spermidine synthase (speE)

Ask
View Details
Recombinant Leptospira biflexa serovar Patoc Spermidine synthase (speE)
MBS1112352-06 0.02 mg (Mammalian-Cell)

Recombinant Leptospira biflexa serovar Patoc Spermidine synthase (speE)

Ask
View Details