Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCL13 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

C-X-C motif chemokine ligand 13

Gene Aliases

ANGIE; ANGIE2; b cell-attracting chemokine 1; b lymphocyte chemoattractant; BCA1; BCA-1; B-cell chemoattractant; B-cell-attracting chemokine 1; B-cell-homing chemokine (ligand for Burkitt's lymphoma receptor-1) ; BLC; BLR1L; B-lymphocyte chemoattractant; chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant) ; CXC chemokine BLC; C-X-C motif chemokine 13; SCYB13; small inducible cytokine B subfamily (Cys-X-Cys motif), member 13 (B-cell chemoattractant) ; small-inducible cytokine B13.

Gene ID

10563

Reactivity

Homo sapiens|Human

Target

Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.

Type

Protein

Source

E.coli

Sequence

VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

12.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CXCL13

Protein Name

C-X-C motif chemokine 13

Gene Name URL

CXCL13

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human S100 Calcium Binding Protein A10 (Recombinant)
22060474-1 2 µg

Human S100 Calcium Binding Protein A10 (Recombinant)

Sign In for Pricing
View Details
Monkey CASP3 (Caspase 3) ELISA Kit
MBS2512449-01 24 Tests

Monkey CASP3 (Caspase 3) ELISA Kit

Sign In for Pricing
View Details
Monkey CASP3 (Caspase 3) ELISA Kit
MBS2512449-02 48 Tests

Monkey CASP3 (Caspase 3) ELISA Kit

Sign In for Pricing
View Details
Monkey CASP3 (Caspase 3) ELISA Kit
MBS2512449-03 96 Tests

Monkey CASP3 (Caspase 3) ELISA Kit

Sign In for Pricing
View Details
Monkey CASP3 (Caspase 3) ELISA Kit
MBS2512449-04 5x 96 Tests

Monkey CASP3 (Caspase 3) ELISA Kit

Sign In for Pricing
View Details
Monkey CASP3 (Caspase 3) ELISA Kit
MBS2512449-05 10x 96 Tests

Monkey CASP3 (Caspase 3) ELISA Kit

Sign In for Pricing
View Details