Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCL1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

C-X-C motif chemokine ligand 1

Gene Aliases

Chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) ; C-X-C motif chemokine 1; fibroblast secretory protein; FSP; GRO1; GRO1 oncogene (melanoma growth stimulating activity, alpha) ; GRO1 oncogene (melanoma growth-stimulating activity) ; GROa; GRO-alpha (1-73) ; growth-regulated alpha protein; melanoma growth stimulating activity, alpha; Melanoma growth stimulatory activity; melanoma growth stimulatory activity alpha; MGSA; MGSA alpha; MGSA-a; NAP-3; neutrophil-activating protein 3; SCYB1.

Gene ID

2919

Reactivity

Homo sapiens|Human

Target

Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha (4-73), GRO-alpha (5-73) and GRO-alpha (6-73) show a 30-fold higher chemotactic activity.

Type

Protein

Source

E.coli

Sequence

ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

11.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CXCL1

Protein Name

Growth-regulated alpha protein

Gene Name URL

CXCL1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPP14 Conjugated Antibody
orb1613441 100 µL

RPP14 Conjugated Antibody

Sign In for Pricing
View Details
Rabbit Proteoglycan 4 ELISA Kit
MBS750938-01 48 Well

Rabbit Proteoglycan 4 ELISA Kit

Sign In for Pricing
View Details
Rabbit Proteoglycan 4 ELISA Kit
MBS750938-02 96 Well

Rabbit Proteoglycan 4 ELISA Kit

Sign In for Pricing
View Details
Rabbit Proteoglycan 4 ELISA Kit
MBS750938-03 5x 96 Well

Rabbit Proteoglycan 4 ELISA Kit

Sign In for Pricing
View Details
Rabbit Proteoglycan 4 ELISA Kit
MBS750938-04 10x 96 Well

Rabbit Proteoglycan 4 ELISA Kit

Sign In for Pricing
View Details
PALMD Knockout MES-OV Polyclonal Cells
ARG6719 1 Million

PALMD Knockout MES-OV Polyclonal Cells

Sign In for Pricing
View Details