Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNTF Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Ciliary neurotrophic factor

Gene Aliases

Ciliary Neuronotrophic Factor; ciliary neurotrophic factor; HCNTF.

Gene ID

1270

Reactivity

Homo sapiens|Human

Target

CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy.

Type

Protein

Source

E.coli

Sequence

TEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIAN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

26.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CNTF

Protein Name

Ciliary neurotrophic factor

Gene Name URL

CNTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Azlon Bottle PP 20L Narrow Neck
BOT0283 1 Each

Azlon Bottle PP 20L Narrow Neck

Sign In for Pricing
View Details
ZBTB7C Human Pre-designed siRNA Set A
HY-RS15981 1 Set

ZBTB7C Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit cardiac isoform of Tropnin T  ELISA Kit
ELA-E1339Rb 96 Tests

Rabbit cardiac isoform of Tropnin T ELISA Kit

Sign In for Pricing
View Details
Volatile Organics Combination Mix C - 1ML
624-C 1 mL

Volatile Organics Combination Mix C - 1ML

Sign In for Pricing
View Details
Coronin 6 siRNA (h)
sc-93780 10 µM

Coronin 6 siRNA (h)

Sign In for Pricing
View Details
TGFB1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV699533 1.0 µg DNA

TGFB1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details