What is the catalog number for Recombinant human C-C motif chemokine 22?

The catalog number for Recombinant human C-C motif chemokine 22 is OPCA00608-100UG.

What sizes are available for Recombinant human C-C motif chemokine 22?

Recombinant human C-C motif chemokine 22 is available in the following size(s): 100 µg.

Is Recombinant human C-C motif chemokine 22 in stock?

Recombinant human C-C motif chemokine 22 is currently made to order / not held in immediate stock. Contact us for lead time.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

Recombinant human C-C motif chemokine 22

Product Specifications

CAS Number

9000-83-3

Gene Name

C-C motif chemokine ligand 22

Gene Aliases

A-152E5.1; ABCD-1; CC chemokine STCP-1; C-C motif chemokine 22; chemokine (C-C motif) ligand 22; DC/B-CK; macrophage-derived chemokine; MDC; MDC (1-69) ; SCYA22; small inducible cytokine A22; small inducible cytokine subfamily A (Cys-Cys), member 22; Small-inducible cytokine A22; STCP-1; stimulated T cell chemotactic protein 1; Stimulated T-cell chemotactic protein 1.

Gene ID

6367

Reactivity

Homo sapiens|Human

Target

May play a role in the trafficking of activated/effector T-lymphocytes to inflammatory sites and other aspects of activated T-lymphocyte physiology. Chemotactic for monocytes, dendritic cells and natural killer cells. Mild chemoattractant for primary activated T-lymphocytes and a potent chemoattractant for chronically activated T-lymphocytes but has no chemoattractant activity for neutrophils, eosinophils, and resting T-lymphocytes. Binds to CCR4. Processed forms MDC (3-69), MDC (5-69) and MDC (7-69) seem not be active.

Type

Protein

Source

E.coli

Sequence

GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.