Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL20 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

C-C motif chemokine ligand 20

Gene Aliases

Beta chemokine exodus-1; Beta-chemokine exodus-1; CC chemokine LARC; C-C motif chemokine 20; chemokine (C-C motif) ligand 20; CKb4; Exodus; LARC; liver and activation-regulated chemokine; macrophage inflammatory protein 3 alpha; MIP-3a; MIP3A; MIP-3-alpha; SCYA20; small inducible cytokine subfamily A (Cys-Cys), member 20; small-inducible cytokine A20; ST38.

Gene ID

6364

Reactivity

Homo sapiens|Human

Target

Acts as a ligand for C-C chemokine receptor CCR6. Signals through binding and activation of CCR6 and induces a strong chemotactic response and mobilization of intracellular calcium ions (PubMed:11352563, PubMed:11035086, PubMed:20068036) . The ligand-receptor pair CCL20-CCR6 is responsible for the chemotaxis of dendritic cells (DC), effector/memory T-cells and B-cells and plays an important role at skin and mucosal surfaces under homeostatic and inflammatory conditions, as well as in pathology, including cancer and various autoimmune diseases (PubMed:21376174) . CCL20 acts as a chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes (PubMed:9038201, PubMed:11352563) . Involved in the recruitment of both the proinflammatory IL17 producing helper T-cells (Th17) and the regulatory T-cells (Treg) to sites of inflammation. Required for optimal migration of thymic natural regulatory T cells (nTregs) and DN1 early thymocyte progenitor cells (By similarity) . C-terminal processed forms have been shown to be equally chemotactically active for leukocytes (PubMed:11035086) . Positively regulates sperm motility and chemotaxis via its binding to CCR6 which triggers Ca2+ mobilization in the sperm which is important for its motility (PubMed:23765988, PubMed:25122636) . Inhibits proliferation of myeloid progenitors in colony formation assays (PubMed:9129037) . May be involved in formation and function of the mucosal lymphoid tissues by attracting lymphocytes and dendritic cells towards epithelial cells (By similarity) . Possesses antibacterial activity towards E.coli ATCC 25922 and S.aureus ATCC 29213 (PubMed:12149255) .

Type

Protein

Source

E.coli

Sequence

ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

34.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CCL20

Protein Name

C-C motif chemokine 20

Gene Name URL

CCL20

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Vibrio Cholerae rplT Protein (aa 1-117) (strain M66-2)
VAng-Cr2694-1mgEcoli 1 mg (E. coli)

Recombinant Vibrio Cholerae rplT Protein (aa 1-117) (strain M66-2)

Sign In for Pricing
View Details
Rabbit Polyclonal GDAP2 Antibody
NBP1-91932-25ul 25 µL

Rabbit Polyclonal GDAP2 Antibody

Sign In for Pricing
View Details
SLC7A8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2163408 1.0 µg DNA

SLC7A8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Calcium Carbonate 96.8%
GPC4466-25Y 25 Kg

Calcium Carbonate 96.8%

Sign In for Pricing
View Details
PCMV-EGFP-PPARGC1A-Neo Plasmid
PVT73822 2 µg

PCMV-EGFP-PPARGC1A-Neo Plasmid

Sign In for Pricing
View Details
1- (3,4-Dichlorobenzyl) -6-oxo-1,6-dihydro-3-pyridinecarboxylic acid
sc-302187A 5 mg

1- (3,4-Dichlorobenzyl) -6-oxo-1,6-dihydro-3-pyridinecarboxylic acid

Sign In for Pricing
View Details