Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Caspase-1

Product Specifications

CAS Number

9000-83-3

Gene Name

Caspase 1

Gene Aliases

CASP1 nirs variant 1; caspase 1, apoptosis-related cysteine peptidase; caspase-1; caspase-1 isoform alpha; ICE; IL-1 beta-converting enzyme; IL1BC; IL1B-convertase; interleukin 1, beta, convertase; interleukin 1-B converting enzyme; Interleukin-1 beta convertase; Interleukin-1 beta-converting enzyme; P45.

Gene ID

834

Reactivity

Homo sapiens|Human

Target

Thiol protease that cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes. Important for defense against pathogens. Cleaves and activates sterol regulatory element binding proteins (SREBPs) . Can also promote apoptosis. Upon inflammasome activation, during DNA virus infection but not RNA virus challenge, controls antiviral immunity through the cleavage of CGAS, rendering it inactive (PubMed:28314590) .

Type

Protein

Source

E.coli

Sequence

NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

43.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CASP1

Protein Name

Caspase-1

Gene Name URL

CASP1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse matrix metalloproteinase 13, MMP-13 ELISA kit
CSB-E07413m-01 48 Tests

Mouse matrix metalloproteinase 13, MMP-13 ELISA kit

Sign In for Pricing
View Details
Mouse matrix metalloproteinase 13, MMP-13 ELISA kit
CSB-E07413m-02 96 Tests

Mouse matrix metalloproteinase 13, MMP-13 ELISA kit

Sign In for Pricing
View Details
Mouse matrix metalloproteinase 13, MMP-13 ELISA kit
CSB-E07413m-03 5x 96 Tests

Mouse matrix metalloproteinase 13, MMP-13 ELISA kit

Sign In for Pricing
View Details
Mouse matrix metalloproteinase 13, MMP-13 ELISA kit
CSB-E07413m-04 10x 96 Tests

Mouse matrix metalloproteinase 13, MMP-13 ELISA kit

Sign In for Pricing
View Details
Mouse 1, 5-Anhydroglucitol (1, 5-AG) ELISA Kit
MBS9303670-01 48 Well

Mouse 1, 5-Anhydroglucitol (1, 5-AG) ELISA Kit

Sign In for Pricing
View Details
Mouse 1, 5-Anhydroglucitol (1, 5-AG) ELISA Kit
MBS9303670-02 96 Well

Mouse 1, 5-Anhydroglucitol (1, 5-AG) ELISA Kit

Sign In for Pricing
View Details