Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGPT2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Angiopoietin 2

Gene Aliases

AGPT2; ANG2; angiopoietin-2; angiopoietin-2a; angiopoietin-2B; LMPHM10; Tie2-ligand.

Gene ID

285

Reactivity

Homo sapiens|Human

Target

Binds to TEK/TIE2, competing for the ANGPT1 binding site, and modulating ANGPT1 signaling. Can induce tyrosine phosphorylation of TEK/TIE2 in the absence of ANGPT1. In the absence of angiogenic inducers, such as VEGF, ANGPT2-mediated loosening of cell-matrix contacts may induce endothelial cell apoptosis with consequent vascular regression. In concert with VEGF, it may facilitate endothelial cell migration and proliferation, thus serving as a permissive angiogenic signal.

Type

Protein

Source

E.coli

Sequence

YNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

57.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ANGPT2

Protein Name

Angiopoietin-2

Gene Name URL

ANGPT2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PYROXD1 Antibody Picoband® (Biotine Conjugate)
A17214-4-Biotin 100 µg/Vial

Anti-PYROXD1 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
Recombinant Mouse FKBP12 / FKBP1A Protein (His tag)
E53A06766 50 µg

Recombinant Mouse FKBP12 / FKBP1A Protein (His tag)

Sign In for Pricing
View Details
VTA1 Protein Lysate (Rat) with C-HA Tag
50218036 100 µg

VTA1 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
NUPL1 Polyclonal Antibody, Biotin Conjugated
bs-19569R-Biotin 100 µL

NUPL1 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
(2E) -2-[ (4-Methylphenyl) methylene]-N-phenylhydrazinecarbothioamide
421526-01 50 mg

(2E) -2-[ (4-Methylphenyl) methylene]-N-phenylhydrazinecarbothioamide

Sign In for Pricing
View Details
(2E) -2-[ (4-Methylphenyl) methylene]-N-phenylhydrazinecarbothioamide
421526-02 100 mg

(2E) -2-[ (4-Methylphenyl) methylene]-N-phenylhydrazinecarbothioamide

Sign In for Pricing
View Details