Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Endoplasmic reticulum resident protein 29

Product Specifications

CAS Number

9000-83-3

Gene Name

Endoplasmic reticulum protein 29

Gene Aliases

C12orf8; endoplasmic reticulum lumenal protein ERp28; endoplasmic reticulum resident protein 28; endoplasmic reticulum resident protein 29; endoplasmic reticulum resident protein 31; epididymis secretory protein Li 107; ERp28; ERp31; HEL-S-107; PDIA9; PDI-DB; protein disulfide isomerase family A, member 9.

Gene ID

10961

Reactivity

Homo sapiens|Human

Target

Does not seem to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER.

Type

Protein

Source

E.coli

Sequence

PLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

51 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ERP29

Protein Name

Endoplasmic reticulum resident protein 29

Gene Name URL

ERP29

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine7 Rat IgG2a, κ Isotype Control
DL22530F-01 25 μg

PE/Cyanine7 Rat IgG2a, κ Isotype Control

Sign In for Pricing
View Details
PE/Cyanine7 Rat IgG2a, κ Isotype Control
DL22530F-02 50 μg

PE/Cyanine7 Rat IgG2a, κ Isotype Control

Sign In for Pricing
View Details
PE/Cyanine7 Rat IgG2a, κ Isotype Control
DL22530F-03 100 μg

PE/Cyanine7 Rat IgG2a, κ Isotype Control

Sign In for Pricing
View Details
PE/Cyanine7 Rat IgG2a, κ Isotype Control
DL22530F-04 200 μg

PE/Cyanine7 Rat IgG2a, κ Isotype Control

Sign In for Pricing
View Details
Mouse Gpank1 activation kit by CRISPRa
GA211194 1 Kit

Mouse Gpank1 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Ceruloplasmin (CP) ELISA Kit
MBS458531-01 48 Tests

Mouse Ceruloplasmin (CP) ELISA Kit

Sign In for Pricing
View Details