Recombinant human Endoplasmic reticulum resident protein 29
Product Specifications
CAS Number
9000-83-3
Gene Name
Endoplasmic reticulum protein 29
Gene Aliases
C12orf8; endoplasmic reticulum lumenal protein ERp28; endoplasmic reticulum resident protein 28; endoplasmic reticulum resident protein 29; endoplasmic reticulum resident protein 31; epididymis secretory protein Li 107; ERp28; ERp31; HEL-S-107; PDIA9; PDI-DB; protein disulfide isomerase family A, member 9.
Gene ID
10961
Reactivity
Homo sapiens|Human
Target
Does not seem to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER.
Type
Protein
Source
E.coli
Sequence
PLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAF
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions
Reconstitution & Storage Instructions
Western Blotting/Immunoblotting (WB/IB) Protocol
Western Blotting/Immunoblotting (WB/IB) Protocol
Immunohistochemistry (IHC) Protocol
Immunohistochemistry (IHC) Protocol
Immunocytochemistry (ICC) Protocol
Immunocytochemistry (ICC) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Blocking Peptide Competition Protocol (BPCP)
Blocking Peptide Competition Protocol (BPCP)
Immunoprecipitation (IP) Protocol
Immunoprecipitation (IP) Protocol
Antibody Array (AA) Protocol
Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
51 kDa
Protein Length
Recombinant
NCBI Gene Symbol
ERP29
Protein Name
Endoplasmic reticulum resident protein 29
Gene Name URL
ERP29
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
19355141 1x 10^6 Cells / 1.0 mL
EPHA2 CRISPR Knock Out 293T Cell Line (Human)
Sign In for Pricing
View Details 
MBS6381344-01 0.1 mL
HMG2 (High-mobility Group Box 2, High Mobility Group Protein B2, High Mobility Group Protein 2, HMG-2, HMGB2) (Biotin)
Sign In for Pricing
View Details MBS6381344-02 5x 0.1 mL
HMG2 (High-mobility Group Box 2, High Mobility Group Protein B2, High Mobility Group Protein 2, HMG-2, HMGB2) (Biotin)
Sign In for Pricing
View Details 
032641-ML550 100 µL
C10orf2, CT (PEO1, C10orf2, Twinkle protein, mitochondrial, Progressive external ophthalmoplegia 1 protein, T7 gp4-like protein with intramitochondrial nucleoid localization, T7-like mitochondrial DNA helicase) (MaxLight 550) discontinued
Sign In for Pricing
View Details MBS6414324-01 0.1 mL
DNAJB1 (DnaJ Homolog Subfamily B Member 1, Heat Shock 40kD Protein 1, Heat Shock Protein 40, Hdj1, Sis1, HSPF1, Hsp40, RSPH16B) (MaxLight 405)
Sign In for Pricing
View Details