What sizes are available for Recombinant human Myosin light polypeptide 6 protein?

Recombinant human Myosin light polypeptide 6 protein is available in the following size(s): 1 mg.

Recombinant human Myosin light polypeptide 6 protein

Q: What is the catalog number for Recombinant human Myosin light polypeptide 6 protein?

The catalog number for Recombinant human Myosin light polypeptide 6 protein is OPCA00571-1MG.

Q: Is Recombinant human Myosin light polypeptide 6 protein in stock?

Recombinant human Myosin light polypeptide 6 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Product Specifications

CAS Number

9000-83-3

Gene Name

Myosin light chain 6

Gene Aliases

17 kDa myosin light chain; ESMLC; LC17; LC17A; LC17B; LC17-GI; LC17-NM; MLC1SM; MLC-3; MLC3NM; MLC3SM; Myosin light chain 3; myosin light chain A3; myosin light chain alkali 3; myosin light polypeptide 6; myosin, light chain 6, alkali, smooth muscle and non-muscle; myosin, light polypeptide 6, alkali, smooth muscle and non-muscle; Smooth muscle and nonmuscle myosin light chain alkali 6.

Gene ID

4637

Reactivity

Homo sapiens|Human

Target

Regulatory light chain of myosin. Does not bind calcium.

Type

Protein

Source

E.coli

Sequence

DFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.