Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Eukaryotic translation initiation factor 1 protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Eukaryotic translation initiation factor 1

Gene Aliases

A121; EIF-1; EIF1A; eukaryotic translation initiation factor 1; ISO1; protein translation factor SUI1 homolog; SUI1; sui1iso1.

Gene ID

10209

Reactivity

Homo sapiens|Human

Target

Necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA.

Type

Protein

Source

E.coli

Sequence

MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

EIF1

Protein Name

Eukaryotic translation initiation factor 1

Gene Name URL

EIF1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Alzheimer-Associated Neuronal Thread Protein ELISA Kit
MBS045619 Inquire

Goat Alzheimer-Associated Neuronal Thread Protein ELISA Kit

Sign In for Pricing
View Details
Deoxyribonuclease I like 1 (DNASE1L1) (NM_006730) Human Tagged ORF Clone Lentiviral Particle
RC207005L4V 200 µL

Deoxyribonuclease I like 1 (DNASE1L1) (NM_006730) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Pinacolone Oxime
P19555 10 g

Pinacolone Oxime

Sign In for Pricing
View Details
Recombinant Mouse Reg3b Protein, N-GST & C-His
bs-106102P-01 20 µg

Recombinant Mouse Reg3b Protein, N-GST & C-His

Sign In for Pricing
View Details
Recombinant Mouse Reg3b Protein, N-GST & C-His
bs-106102P-02 50 µg

Recombinant Mouse Reg3b Protein, N-GST & C-His

Sign In for Pricing
View Details
Ro3280
orb1305238-01 1 mg

Ro3280

Sign In for Pricing
View Details