Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Charged multivesicular body protein 2a

Product Specifications

CAS Number

9000-83-3

Gene Name

Charged multivesicular body protein 2A

Gene Aliases

BC2; BC-2; charged multivesicular body protein 2a; CHMP2; chromatin modifying protein 2A; Chromatin-modifying protein 2a; putative breast adenocarcinoma marker (32kD) ; putative breast adenocarcinoma marker BC-2; vacuolar protein sorting-associated protein 2-1; VPS2; VPS2 homolog A; vps2-1; VPS2A.

Gene ID

27243

Reactivity

Homo sapiens|Human

Target

Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I, -II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis (PubMed:21310966) . Together with SPAST, the ESCRT-III complex promotes nuclear envelope sealing and mitotic spindle disassembly during late anaphase (PubMed:26040712) . ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4.

Type

Protein

Source

E.coli

Sequence

MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLRRD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

52.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CHMP2A

Protein Name

Charged multivesicular body protein 2a

Gene Name URL

CHMP2A

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Treponema pallidum Chaperone protein htpG (htpG), partial
MBS1229677 Inquire

Recombinant Treponema pallidum Chaperone protein htpG (htpG), partial

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) FEN1 Polyclonal antibody
MBS7139268-01 0.05 mL

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) FEN1 Polyclonal antibody

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) FEN1 Polyclonal antibody
MBS7139268-02 0.1 mL

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) FEN1 Polyclonal antibody

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) FEN1 Polyclonal antibody
MBS7139268-03 5x 0.1 mL

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) FEN1 Polyclonal antibody

Sign In for Pricing
View Details
Rabbit anti-human Transcription intermediary factor 1-beta polyclonal Antibody, Biotin conjugated
MBS715940-01 0.05 mg

Rabbit anti-human Transcription intermediary factor 1-beta polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human Transcription intermediary factor 1-beta polyclonal Antibody, Biotin conjugated
MBS715940-02 0.1 mg

Rabbit anti-human Transcription intermediary factor 1-beta polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details