Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Cytochrome b-c1 complex subunit 8

Product Specifications

CAS Number

9000-83-3

Gene Name

Ubiquinol-cytochrome c reductase complex III subunit VII

Gene Aliases

Complex III subunit 8; complex III subunit VIII; cytochrome b-c1 complex subunit 8; low molecular mass ubiquinone-binding protein (9.5kD) ; MC3DN4; QCR8; QPC; QP-C; ubiquinol-cytochrome c reductase complex 9.5 kDa protein; ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C; ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa; UQCR7.

Gene ID

27089

Reactivity

Homo sapiens|Human

Target

This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone.

Type

Protein

Source

E.coli

Sequence

GREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

36.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

UQCRQ

Protein Name

Cytochrome b-c1 complex subunit 8

Gene Name URL

UQCRQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMCR7 Rabbit Polyclonal Antibody (Cy5.5)
orb1077849 100 µL

SMCR7 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
C9orf167 (TOR4A) (NM_017723) Human Tagged ORF Clone
RC215260 10 µg

C9orf167 (TOR4A) (NM_017723) Human Tagged ORF Clone

Sign In for Pricing
View Details
FOXA1 (Forkhead Box A1, HNF3A, MGC33105, TCF3A) (MaxLight 490)
246257-ML490 100 µL

FOXA1 (Forkhead Box A1, HNF3A, MGC33105, TCF3A) (MaxLight 490)

Sign In for Pricing
View Details
Human CD86 ELISA Kit
SEKH-0571-01 48 Tests

Human CD86 ELISA Kit

Sign In for Pricing
View Details
Human CD86 ELISA Kit
SEKH-0571-02 96 Tests

Human CD86 ELISA Kit

Sign In for Pricing
View Details
PD-1, Nivolumab Biosimilar
587282-01 1 mg

PD-1, Nivolumab Biosimilar

Sign In for Pricing
View Details