Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Cytochrome b-c1 complex subunit 8

Product Specifications

CAS Number

9000-83-3

Gene Name

Ubiquinol-cytochrome c reductase complex III subunit VII

Gene Aliases

Complex III subunit 8; complex III subunit VIII; cytochrome b-c1 complex subunit 8; low molecular mass ubiquinone-binding protein (9.5kD) ; MC3DN4; QCR8; QPC; QP-C; ubiquinol-cytochrome c reductase complex 9.5 kDa protein; ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C; ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa; UQCR7.

Gene ID

27089

Reactivity

Homo sapiens|Human

Target

This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone.

Type

Protein

Source

E.coli

Sequence

GREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

36.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

UQCRQ

Protein Name

Cytochrome b-c1 complex subunit 8

Gene Name URL

UQCRQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KISS1 Polyclonal Antibody
E916692 100 µL

KISS1 Polyclonal Antibody

Sign In for Pricing
View Details
Vimentin Antibody
48952-01 50 µL

Vimentin Antibody

Sign In for Pricing
View Details
Vimentin Antibody
48952-02 100 µL

Vimentin Antibody

Sign In for Pricing
View Details
Porcine Pancreatic Epithelial Primary Cells
CC11L124 5x 10^5 Cells/Vial

Porcine Pancreatic Epithelial Primary Cells

Sign In for Pricing
View Details
HS1BP3 Protein Vector (Mouse) (pPM-C-HA)
PV189880 500 ng

HS1BP3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
PTCHD3 Polyclonal Antibody, Cy5.5 Conjugated
bs-12325R-Cy5.5 100 µL

PTCHD3 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details