Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human protein phosphatase 1 regulatory subunit 11

Product Specifications

CAS Number

9000-83-3

Gene Name

Protein phosphatase 1 regulatory inhibitor subunit 11

Gene Aliases

CFAP255; E3 ubiquitin-protein ligase PPP1R11; HCG V; HCGV; HCG-V; hemochromatosis candidate gene V protein; inhibitor-3; IPP3; protein phosphatase 1 regulatory subunit 11; protein phosphatase inhibitor 3; t-complex-associated-testis-expressed 5; TCTE5; TCTEX5.

Gene ID

6992

Reactivity

Homo sapiens|Human

Target

Atypical E3 ubiquitin-protein ligase which ubiquitinates TLR2 at 'Lys-754' leading to its degradation by the proteasome. Plays a role in regulating inflammatory cytokine release and gram-positive bacterial clearance by functioning, in part, through the ubiquitination and degradation of TLR2 (PubMed:27805901) . Inhibitor of protein phosphatase 1 (PubMed:9843442) .

Type

Protein

Source

E.coli

Sequence

MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAFGESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPPPGPMQH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

41 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PPP1R11

Protein Name

E3 ubiquitin-protein ligase PPP1R11

Gene Name URL

PPP1R11

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MLPH/Melanophilin ELISA Kit
E1602Hu 96 Tests

Human MLPH/Melanophilin ELISA Kit

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (LAMP3/2881), CF405S conjugate, 0.1mg/mL
BNC042881-100 1x 100 µL

CD63 (Late Endosomes Marker) (LAMP3/2881), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5L Polyclonal Antibody, APC Conjugated
bs-2487R-APC 100 µL

CD5L Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to POTE Ankyrin Domain Family, Member G (POTEG)
MBS2083924-01 0.1 mL

HRP-Linked Polyclonal Antibody to POTE Ankyrin Domain Family, Member G (POTEG)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to POTE Ankyrin Domain Family, Member G (POTEG)
MBS2083924-02 0.2 mL

HRP-Linked Polyclonal Antibody to POTE Ankyrin Domain Family, Member G (POTEG)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to POTE Ankyrin Domain Family, Member G (POTEG)
MBS2083924-03 0.5 mL

HRP-Linked Polyclonal Antibody to POTE Ankyrin Domain Family, Member G (POTEG)

Sign In for Pricing
View Details