Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Cytochrome b-c1 complex subunit 10 protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Ubiquinol-cytochrome c reductase, complex III subunit XI

Gene Aliases

0710008D09Rik; complex III subunit 10; complex III subunit XI; cytochrome b-c1 complex subunit 10; QCR10; ubiquinol-cytochrome c reductase complex 6.4 kDa protein; ubiquinol-cytochrome c reductase, 6.4kDa subunit; UQCR.

Gene ID

10975

Reactivity

Homo sapiens|Human

Target

This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain.

Type

Protein

Source

E.coli

Sequence

MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

UQCR11

Protein Name

Cytochrome b-c1 complex subunit 10

Gene Name URL

UQCR11

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT4 Monoclonal Antibody, AbBy Fluor™ 350 Conjugated
bsm-52236R-BF350 100 µL

STAT4 Monoclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Factor XIII (F13B) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A3]
TA805990BM 100 µL

Factor XIII (F13B) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A3]

Sign In for Pricing
View Details
ABCF2 antibody
70R-50770 100 µL

ABCF2 antibody

Sign In for Pricing
View Details
Chicken Parathyroid Hormone Related Protein ELISA Kit
MBS737934-01 48 Well

Chicken Parathyroid Hormone Related Protein ELISA Kit

Sign In for Pricing
View Details
Chicken Parathyroid Hormone Related Protein ELISA Kit
MBS737934-02 96 Well

Chicken Parathyroid Hormone Related Protein ELISA Kit

Sign In for Pricing
View Details
Chicken Parathyroid Hormone Related Protein ELISA Kit
MBS737934-03 5x 96 Well

Chicken Parathyroid Hormone Related Protein ELISA Kit

Sign In for Pricing
View Details