What sizes are available for Recombinant human Cytochrome b-c1 complex subunit 10 protein?

Recombinant human Cytochrome b-c1 complex subunit 10 protein is available in the following size(s): 100 µg.

Recombinant human Cytochrome b-c1 complex subunit 10 protein

Q: What is the catalog number for Recombinant human Cytochrome b-c1 complex subunit 10 protein?

The catalog number for Recombinant human Cytochrome b-c1 complex subunit 10 protein is OPCA00523-100UG.

Product Specifications

CAS Number

9000-83-3

Gene Name

Ubiquinol-cytochrome c reductase, complex III subunit XI

Gene Aliases

0710008D09Rik; complex III subunit 10; complex III subunit XI; cytochrome b-c1 complex subunit 10; QCR10; ubiquinol-cytochrome c reductase complex 6.4 kDa protein; ubiquinol-cytochrome c reductase, 6.4kDa subunit; UQCR.

Gene ID

10975

Reactivity

Homo sapiens|Human

Target

This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain.

Type

Protein

Source

E.coli

Sequence

MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.