Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Negative elongation factor B

Product Specifications

CAS Number

9000-83-3

Gene Name

Negative elongation factor complex member B

Gene Aliases

COBRA1; cofactor of BRCA1; negative elongation factor B; negative elongation factor protein B; NELF-B.

Gene ID

25920

Reactivity

Homo sapiens|Human

Target

Essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II. The NELF complex, which acts via an association with the DSIF complex and causes transcriptional pausing, is counteracted by the P-TEFb kinase complex. The NELF complex is involved in HIV-1 latency possibly involving recruitment of PCF11 to paused RNA polymerase II. Binds RNA which may help to stabilize the NELF complex on nucleic acid. In vitro, binds weakly to the HIV-1 TAR RNA which is located in the long terminal repeat (LTR) of HIV-1. May be able to induce chromatin unfolding.

Type

Protein

Source

E.coli

Sequence

LGVANGEDLKETLTNCTEPLKAIEQFQTENGVLLPSLQSALPFLDLHGTPRLEFHQSVFDELRDKLLERVSAIASEGKAEERYKKLEDLLEKSFSLVKMPSLQPVVMCVMKHLPKVPEKKLKLVMADKELYRACAVEVKRQIWQDNQALFGDEVSPLLKQYILEKESALFSTELSVLHNFFSPSPKTRRQGE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

48.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

NELFB

Protein Name

Negative elongation factor B

Gene Name URL

NELFB

More Discoveries

Explore Other Products

Browse additional items from our catalog

DBLOH Polyclonal Antibody
BT-AP08389-01 20 µL

DBLOH Polyclonal Antibody

Sign In for Pricing
View Details
DBLOH Polyclonal Antibody
BT-AP08389-02 50 µL

DBLOH Polyclonal Antibody

Sign In for Pricing
View Details
DBLOH Polyclonal Antibody
BT-AP08389-03 100 µL

DBLOH Polyclonal Antibody

Sign In for Pricing
View Details
Bismuth subnitrate
GK1477-250g 250 g

Bismuth subnitrate

Sign In for Pricing
View Details
GUCY2F Protein
MBS517023-01 0.02 mg

GUCY2F Protein

Sign In for Pricing
View Details
GUCY2F Protein
MBS517023-02 0.1 mg

GUCY2F Protein

Sign In for Pricing
View Details