Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Zinc finger protein 592

Product Specifications

CAS Number

9000-83-3

Gene Name

Zinc finger protein 592

Gene Aliases

CAMOS; SCAR5; zinc finger protein 592.

Gene ID

9640

Reactivity

Homo sapiens|Human

Target

May be involved in transcriptional regulation.

Type

Protein

Source

E.coli

Sequence

MGDMKTPDFDDLLAAFDIPDPTSLDAKEAIQTPSEENESPLKPPGICMDESVSLSHSGSAPDVPAVSVIVKNTSRQESFEAEKDHITPSLLHNGFRGSDLPPDPHNCGKFDSTFMNGDSARSFPGKLEPPKSEPLPTFNQFSPISSPEPEDPIKDNGFGIKPKHSDSYFPPPLGCGAVGGPVLEALAKFPVPELHMFDHFCKKEPKPEPLPLGSQQEHEQSGQNTVEPHKDPDATRFFGEAL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

53.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ZNF592

Protein Name

Zinc finger protein 592

Gene Name URL

ZNF592

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Txn1 (NM_053800) Rat Tagged ORF Clone
RR207029 10 µg

Txn1 (NM_053800) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Olr439 Protein Lysate (Rat) with C-HA Tag
34405036 100 µg

Olr439 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Gja3 3'UTR GFP Stable Cell Line
TU255108 1.0 mL

Gja3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Tpt1 AAV siRNA Pooled Vector
47409166 1.0 µg

Tpt1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Mouse Monoclonal Pax3 Antibody (PAX3/8426) [CoraFluor 1]
NBP3-20757CL1 0.1 mL

Mouse Monoclonal Pax3 Antibody (PAX3/8426) [CoraFluor 1]

Sign In for Pricing
View Details
SNTN Protein
OPPA00118-5UG 5 µg

SNTN Protein

Sign In for Pricing
View Details