Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAP1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

TNF receptor associated protein 1

Gene Aliases

Heat shock protein 75 kDa, mitochondrial; HSP 75; HSP75; HSP90L; testicular tissue protein Li 209; TNFR-associated protein 1; TRAP-1; tumor necrosis factor type 1 receptor-associated protein.

Gene ID

10131

Reactivity

Homo sapiens|Human

Target

Chaperone that expresses an ATPase activity. Involved in maintaining mitochondrial function and polarization, downstream of PINK1 and mitochondrial complex I. Is a negative regulator of mitochondrial respiration able to modulate the balance between oxidative phosphorylation and aerobic glycolysis. The impact of TRAP1 on mitochondrial respiration is probably mediated by modulation of mitochondrial SRC and inhibition of SDHA.

Type

Protein

Source

E.coli

Sequence

STQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKLVSDGQALPEMEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGSKAFLDALQNQAEASSKIIGQFGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDGSGVFEIAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAIWMMDPKDVRE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

54.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TRAP1

Protein Name

Heat shock protein 75 kDa, mitochondrial

Gene Name URL

TRAP1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Muffle Box Furnace (BER-8511)
BER-8511 1 Unit

Muffle Box Furnace (BER-8511)

Sign In for Pricing
View Details
HAP40 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-11696R-BF488 100 µL

HAP40 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
IRF-7 (Phospho-Ser471/472) rabbit pAb
MBS9458955-01 0.05 mL

IRF-7 (Phospho-Ser471/472) rabbit pAb

Sign In for Pricing
View Details
IRF-7 (Phospho-Ser471/472) rabbit pAb
MBS9458955-02 0.1 mL

IRF-7 (Phospho-Ser471/472) rabbit pAb

Sign In for Pricing
View Details
IRF-7 (Phospho-Ser471/472) rabbit pAb
MBS9458955-03 5x 0.1 mL

IRF-7 (Phospho-Ser471/472) rabbit pAb

Sign In for Pricing
View Details
Vasopressin (AVP) Mouse Monoclonal Antibody [Clone ID: VAS 15-1-4]
AM02264PU-S 10 µg

Vasopressin (AVP) Mouse Monoclonal Antibody [Clone ID: VAS 15-1-4]

Sign In for Pricing
View Details