Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Actin-related protein 2/3 complex subunit 3

Product Specifications

CAS Number

9000-83-3

Gene Name

Actin related protein 2/3 complex subunit 3

Gene Aliases

Actin related protein 2/3 complex, subunit 3, 21kDa; actin-related protein 2/3 complex subunit 3; ARC21; arp2/3 complex 21 kDa subunit; ARP2/3 protein complex subunit p21; p21-Arc.

Gene ID

10094

Reactivity

Homo sapiens|Human

Target

Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.

Type

Protein

Source

E.coli

Sequence

PAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

47.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ARPC3

Protein Name

Actin-related protein 2/3 complex subunit 3

Gene Name URL

ARPC3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse C1qc shRNA (UAS) - Lentiviral mouse C1qc shRNA (UAS, RFP) (100)
GTR15175788 1 Vial

Lentiviral mouse C1qc shRNA (UAS) - Lentiviral mouse C1qc shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Dync1h1 3'UTR Lenti-reporter-Luc Vector
18752086 1.0 µg

Dync1h1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Mospd1-set siRNA/shRNA/RNAi Lentivector (Rat)
30336096 4x 500 ng

Mospd1-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Mouse RNF41 ELISA kit
ELI-40878m 96 Tests

Mouse RNF41 ELISA kit

Sign In for Pricing
View Details
Microglia Neurodegeneration Module Antibody Sampler Kit
CST 93195T 1 Kit

Microglia Neurodegeneration Module Antibody Sampler Kit

Sign In for Pricing
View Details
Mouse Monoclonal SARS-CoV-2 Spike S1 Protein Antibody (1035226) [DyLight 650]
FAB105805W 0.1 mL

Mouse Monoclonal SARS-CoV-2 Spike S1 Protein Antibody (1035226) [DyLight 650]

Sign In for Pricing
View Details