Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HADHB Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta

Gene Aliases

2-enoyl-Coenzyme A (CoA) hydratase, beta subunit;3-ketoacyl-Coenzyme A (CoA) thiolase of mitochondrial trifunctional protein, beta subunit; acetyl-CoA acyltransferase; beta-ketothiolase; ECHB; hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), beta subunit; hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit; MSTP029; MTPB; TP-BETA; trifunctional enzyme subunit beta, mitochondrial.

Gene ID

3032

Reactivity

Homo sapiens|Human

Target

Recombinant human Trifunctional enzyme subunit beta, mitochondrial

Type

Protein

Source

E.coli

Sequence

APAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNGIRP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

53.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HADHB

Protein Name

Trifunctional enzyme subunit beta, mitochondrial

Gene Name URL

HADHB

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Retinol-binding protein (RBP) ELISA Kit
MBS266302-01 48 Well

Rat Retinol-binding protein (RBP) ELISA Kit

Sign In for Pricing
View Details
Rat Retinol-binding protein (RBP) ELISA Kit
MBS266302-02 96 Well

Rat Retinol-binding protein (RBP) ELISA Kit

Sign In for Pricing
View Details
Rat Retinol-binding protein (RBP) ELISA Kit
MBS266302-03 5x 96 Well

Rat Retinol-binding protein (RBP) ELISA Kit

Sign In for Pricing
View Details
Rat Retinol-binding protein (RBP) ELISA Kit
MBS266302-04 10x 96 Well

Rat Retinol-binding protein (RBP) ELISA Kit

Sign In for Pricing
View Details
Pivalic Acid for Synthesis
1161000 500 500 g

Pivalic Acid for Synthesis

Sign In for Pricing
View Details
Cxcr1 Mouse Gene Knockout Kit (CRISPR)
KN504049 1 Kit

Cxcr1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details