Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Small nuclear ribonucleo protein Sm D2

Product Specifications

CAS Number

9000-83-3

Gene Name

Small nuclear ribonucleoprotein D2 polypeptide

Gene Aliases

Small nuclear ribonucleoprotein D2 polypeptide 16.5kDa; small nuclear ribonucleoprotein Sm D2; Sm-D2; SMD2; snRNP core protein D2; SNRPD1.

Gene ID

6633

Reactivity

Homo sapiens|Human

Target

Core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Thereby, plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP.

Type

Protein

Source

E.coli

Sequence

MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SNRPD2

Protein Name

Small nuclear ribonucleoprotein Sm D2

Gene Name URL

SNRPD2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Urotensin-2 (UTS2) ELISA kit
CSB-EL025771RA-01 24 Well

Rat Urotensin-2 (UTS2) ELISA kit

Sign In for Pricing
View Details
Rat Urotensin-2 (UTS2) ELISA kit
CSB-EL025771RA-02 96 Well

Rat Urotensin-2 (UTS2) ELISA kit

Sign In for Pricing
View Details
Rat Urotensin-2 (UTS2) ELISA kit
CSB-EL025771RA-03 5x 96 Well

Rat Urotensin-2 (UTS2) ELISA kit

Sign In for Pricing
View Details
Rat Urotensin-2 (UTS2) ELISA kit
CSB-EL025771RA-04 10x 96 Well

Rat Urotensin-2 (UTS2) ELISA kit

Sign In for Pricing
View Details
General Noradrenaline (NE) ELISA Kit
RDR-NE-Ge-96Tests 96 Tests

General Noradrenaline (NE) ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse MAP3K1 Protein, His, E.coli-500ug
QP8830-ec-500ug 500ug

Recombinant Mouse MAP3K1 Protein, His, E.coli-500ug

Sign In for Pricing
View Details