Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FKBP1A Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

FKBP prolyl isomerase 1A

Gene Aliases

12 kDa FK506-binding protein;12 kDa FKBP; calstabin-1; FK506 binding protein 1A, 12kDa; FK506 binding protein12; FK506-binding protein 1; FK506-binding protein 12; FK506-binding protein 1A; FK506-binding protein, T-cell, 12-kD; FKBP1; FKBP12; FKBP-12; FKBP12-Exip3; FKBP-1A; immunophilin FKBP12; peptidyl-prolyl cis-trans isomerase FKBP1A; PKC12; PKCI2; PPIASE; PPIase FKBP1A; protein kinase C inhibitor 2; rotamase.

Gene ID

2280

Reactivity

Homo sapiens|Human

Target

Keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand. Recruits SMAD7 to ACVR1B which prevents the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. May modulate the RYR1 calcium channel activity. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.

Type

Protein

Source

E.coli

Sequence

GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

38.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

FKBP1A

Protein Name

Peptidyl-prolyl cis-trans isomerase FKBP1A

Gene Name URL

FKBP1A

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM43 Recombinant Antibody, APC Conjugated
bsm-62738R-APC 100 µL

TMEM43 Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
HDAC3 Rabbit Polyclonal Antibody (BF750)
orb2482625 100 µL

HDAC3 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
ALDH3B1 (NM_000694) Human Tagged Lenti ORF Clone
RC202242L4 10 µg

ALDH3B1 (NM_000694) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
1- (Pyrimidin-2-yl) -1H-imidazole-4-carboxylic acid dihydrochloride
IXC53255-01 50 mg

1- (Pyrimidin-2-yl) -1H-imidazole-4-carboxylic acid dihydrochloride

Sign In for Pricing
View Details
1- (Pyrimidin-2-yl) -1H-imidazole-4-carboxylic acid dihydrochloride
IXC53255-02 0.5 g

1- (Pyrimidin-2-yl) -1H-imidazole-4-carboxylic acid dihydrochloride

Sign In for Pricing
View Details
Human NBPF11 (NM_001101663) AAV Particle
RC224629A1V 250 µL

Human NBPF11 (NM_001101663) AAV Particle

Sign In for Pricing
View Details