FKBP1A Recombinant Protein (Human)
Product Specifications
CAS Number
9000-83-3
Gene Name
FKBP prolyl isomerase 1A
Gene Aliases
12 kDa FK506-binding protein;12 kDa FKBP; calstabin-1; FK506 binding protein 1A, 12kDa; FK506 binding protein12; FK506-binding protein 1; FK506-binding protein 12; FK506-binding protein 1A; FK506-binding protein, T-cell, 12-kD; FKBP1; FKBP12; FKBP-12; FKBP12-Exip3; FKBP-1A; immunophilin FKBP12; peptidyl-prolyl cis-trans isomerase FKBP1A; PKC12; PKCI2; PPIASE; PPIase FKBP1A; protein kinase C inhibitor 2; rotamase.
Gene ID
2280
Reactivity
Homo sapiens|Human
Target
Keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand. Recruits SMAD7 to ACVR1B which prevents the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. May modulate the RYR1 calcium channel activity. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Type
Protein
Source
E.coli
Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVE
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions
Reconstitution & Storage Instructions
Western Blotting/Immunoblotting (WB/IB) Protocol
Western Blotting/Immunoblotting (WB/IB) Protocol
Immunohistochemistry (IHC) Protocol
Immunohistochemistry (IHC) Protocol
Immunocytochemistry (ICC) Protocol
Immunocytochemistry (ICC) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Blocking Peptide Competition Protocol (BPCP)
Blocking Peptide Competition Protocol (BPCP)
Immunoprecipitation (IP) Protocol
Immunoprecipitation (IP) Protocol
Antibody Array (AA) Protocol
Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
38.2 kDa
Protein Length
Recombinant
NCBI Gene Symbol
FKBP1A
Protein Name
Peptidyl-prolyl cis-trans isomerase FKBP1A
Gene Name URL
FKBP1A
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
133242 100 µg
SFTPD (Pulmonary Surfactant-associated Protein D, PSP-D, SP-D, Collectin-7, Lung Surfactant Protein D, COLEC7, PSPD, SFTP4)
Sign In for Pricing
View Details MBS6198772-01 0.1 mL
Chromogranin A (Beta-Granin, CGA, CHGA, Chromogranin A Parathyroid Secretory Protein 1, ER-37, Pancreastatin, Parastatin, Parathyroid Secretory Protein 1, Pituitary Secretory Protein I, SP-I, Vasostatin I or II) (BSA & Azide Free) (MaxLight 405)
Sign In for Pricing
View Details MBS6198772-02 5x 0.1 mL
Chromogranin A (Beta-Granin, CGA, CHGA, Chromogranin A Parathyroid Secretory Protein 1, ER-37, Pancreastatin, Parastatin, Parathyroid Secretory Protein 1, Pituitary Secretory Protein I, SP-I, Vasostatin I or II) (BSA & Azide Free) (MaxLight 405)
Sign In for Pricing
View Details