Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Rhombotin-1

Product Specifications

CAS Number

9000-83-3

Gene Name

LIM domain only 1

Gene Aliases

Cysteine-rich protein TTG-1; LIM domain only 1 (rhombotin 1) ; LIM domain only protein 1; LMO-1; RBTN1; RHOM1; rhombotin-1; T-cell translocation gene 1; T-cell translocation protein 1; TTG1.

Gene ID

4004

Reactivity

Homo sapiens|Human

Target

May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors.

Type

Protein

Source

E.coli

Sequence

DKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQVQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

44.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LMO1

Protein Name

Rhombotin-1

Gene Name URL

LMO1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcimycin discontinued. See A2297
A2297-01 1 mg

Calcimycin discontinued. See A2297

Sign In for Pricing
View Details
Atp13a4 (NM_172613) Mouse Tagged ORF Clone
MR211751 10 µg

Atp13a4 (NM_172613) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Properdin (CFP) Human shRNA Plasmid Kit (Locus ID 5199)
TR313959 1 Kit

Properdin (CFP) Human shRNA Plasmid Kit (Locus ID 5199)

Sign In for Pricing
View Details
Spike Protein (C-His-AVI, SARS-CoV-2)
P519846 100 µg

Spike Protein (C-His-AVI, SARS-CoV-2)

Sign In for Pricing
View Details
Rat COL12 ELISA Kit (Ready to Use)
orb554810-01 48 Tests

Rat COL12 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Rat COL12 ELISA Kit (Ready to Use)
orb554810-02 96 Tests

Rat COL12 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details