What is the catalog number for Recombinant human Rhombotin-1?

The catalog number for Recombinant human Rhombotin-1 is OPCA00428-100UG.

What sizes are available for Recombinant human Rhombotin-1?

Recombinant human Rhombotin-1 is available in the following size(s): 100 µg.

Is Recombinant human Rhombotin-1 in stock?

Recombinant human Rhombotin-1 is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant human Rhombotin-1

Product Specifications

CAS Number

9000-83-3

Gene Name

LIM domain only 1

Gene Aliases

Cysteine-rich protein TTG-1; LIM domain only 1 (rhombotin 1) ; LIM domain only protein 1; LMO-1; RBTN1; RHOM1; rhombotin-1; T-cell translocation gene 1; T-cell translocation protein 1; TTG1.

Gene ID

4004

Reactivity

Homo sapiens|Human

Target

May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors.

Type

Protein

Source

E.coli

Sequence

DKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQVQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.