Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Ubiquitin-like protein FUBI

Product Specifications

CAS Number

9000-83-3

Gene Aliases

FAU, Ubiquitin-like protein FUBI

Reactivity

Human

Target

Recombinant human Ubiquitin-like protein FUBI

Type

Protein

Source

E.coli

Sequence

MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

41.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

FAU

Protein Name

Homo sapiens FAU, ubiquitin like and ribosomal protein S30 fusion (FAU), mRNA

Gene Name URL

FAU

Nucleotide Accession Number

https://www.ncbi.nlm.nih.gov/nuccore/NM_001997

More Discoveries

Explore Other Products

Browse additional items from our catalog

MFRP (Membrane frizzled-Related Protein, C1QTNF5, FLJ30570, NNO2, rd6) (APC)
MBS6169444-01 0.1 mL

MFRP (Membrane frizzled-Related Protein, C1QTNF5, FLJ30570, NNO2, rd6) (APC)

Sign In for Pricing
View Details
MFRP (Membrane frizzled-Related Protein, C1QTNF5, FLJ30570, NNO2, rd6) (APC)
MBS6169444-02 5x 0.1 mL

MFRP (Membrane frizzled-Related Protein, C1QTNF5, FLJ30570, NNO2, rd6) (APC)

Sign In for Pricing
View Details
Thioredoxin-interacting protein (TXNIP) Rat ELISA Kit
H5766 96 Tests

Thioredoxin-interacting protein (TXNIP) Rat ELISA Kit

Sign In for Pricing
View Details
Sucrose Octasulfate Octatriethylamine Salt (>90%)
TRC-S698992-5G 5 g

Sucrose Octasulfate Octatriethylamine Salt (>90%)

Sign In for Pricing
View Details
NrdB, Recombinant, E. coli, aa2-376, His-Tag (Ribonucleoside-diphosphate Reductase 1 Subunit beta)
374471-01 20 µg

NrdB, Recombinant, E. coli, aa2-376, His-Tag (Ribonucleoside-diphosphate Reductase 1 Subunit beta)

Sign In for Pricing
View Details
NrdB, Recombinant, E. coli, aa2-376, His-Tag (Ribonucleoside-diphosphate Reductase 1 Subunit beta)
374471-02 100 µg

NrdB, Recombinant, E. coli, aa2-376, His-Tag (Ribonucleoside-diphosphate Reductase 1 Subunit beta)

Sign In for Pricing
View Details