Recombinant human ES1 protein homolog, mitochondrial
Product Specifications
CAS Number
9000-83-3
Gene Name
Glutamine amidotransferase class 1 domain containing 3|glutamine amidotransferase class 1 domain containing 3B
Gene Aliases
C21orf33; ES1; ES1 protein homolog, mitochondrial; GATD3A; GATD3B; glutamine amidotransferase class 1 domain containing 3A; glutamine amidotransferase like class 1 domain containing 3A; glutamine amidotransferase like class 1 domain containing 3B; glutamine amidotransferase-like class 1 domain-containing protein 3A, mitochondrial; glutamine amidotransferase-like class 1 domain-containing protein 3B, mitochondrial; GT335; HES1; human HES1 protein, homolog to E.coli and zebrafish ES1 protein; Keio novel protein I; keio novel protein-I; KNPH; KNPI; KNP-I; Protein GT335; Protein HES1; Protein KNP-I; testis secretory sperm-binding protein Li 237E.
Gene ID
102724023|8209
Reactivity
Homo sapiens|Human
Target
Recombinant human ES1 protein homolog, mitochondrial
Type
Protein
Source
E.coli
Sequence
ARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDLANLSAANHDAAIFPGGFGAAKNLSTFAVDGKDCKVNKEVERVLKEFHQAGKPIGLCCIAPVLAAKVLRGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions
Reconstitution & Storage Instructions
Western Blotting/Immunoblotting (WB/IB) Protocol
Western Blotting/Immunoblotting (WB/IB) Protocol
Immunohistochemistry (IHC) Protocol
Immunohistochemistry (IHC) Protocol
Immunocytochemistry (ICC) Protocol
Immunocytochemistry (ICC) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Blocking Peptide Competition Protocol (BPCP)
Blocking Peptide Competition Protocol (BPCP)
Immunoprecipitation (IP) Protocol
Immunoprecipitation (IP) Protocol
Antibody Array (AA) Protocol
Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
50.9 kDa
Protein Length
Recombinant
NCBI Gene Symbol
GATD3|LOC102724023
Protein Name
ES1 protein homolog, mitochondrial|Glutamine amidotransferase-like class 1 domain-containing protein 3, mitochondrial|Putative glutamine amidotransferase-like class 1 domain-containing protein 3B, mitochondrial
Gene Name URL
GATD3|LOC102724023
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400633-100 1x 100 µL
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042748-500 1x 500 µL
AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401209-100 1x 100 µL
CD45RO (UCHL1 + T200/797), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680984-500 1x 500 µL
P21 / WAF1 (HJ21), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details