Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Alpha-endosulfine protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Endosulfine alpha

Gene Aliases

Alpha-endosulfine; ARPP-19e.

Gene ID

2029

Reactivity

Homo sapiens|Human

Target

Protein phosphatase inhibitor that specifically inhibits protein phosphatase 2A (PP2A) during mitosis. When phosphorylated at Ser-67 during mitosis, specifically interacts with PPP2R2D (PR55-delta) and inhibits its activity, leading to inactivation of PP2A, an essential condition to keep cyclin-B1-CDK1 activity high during M phase (By similarity) . Also acts as a stimulator of insulin secretion by interacting with sulfonylurea receptor (ABCC8), thereby preventing sulfonylurea from binding to its receptor and reducing K (ATP) channel currents.

Type

Protein

Source

E.coli

Sequence

MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ENSA

Protein Name

Alpha-endosulfine

Gene Name URL

ENSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Sodium channel protein type 2 subunit alpha
E2382h 96 Tests

ELISA Kit For Sodium channel protein type 2 subunit alpha

Sign In for Pricing
View Details
Horse Chorionic Gonadotrophin beta ELISA Kit
MBS022799-01 48 Well

Horse Chorionic Gonadotrophin beta ELISA Kit

Sign In for Pricing
View Details
Horse Chorionic Gonadotrophin beta ELISA Kit
MBS022799-02 96 Well

Horse Chorionic Gonadotrophin beta ELISA Kit

Sign In for Pricing
View Details
Horse Chorionic Gonadotrophin beta ELISA Kit
MBS022799-03 5x 96 Well

Horse Chorionic Gonadotrophin beta ELISA Kit

Sign In for Pricing
View Details
Horse Chorionic Gonadotrophin beta ELISA Kit
MBS022799-04 10x 96 Well

Horse Chorionic Gonadotrophin beta ELISA Kit

Sign In for Pricing
View Details
Amiodarone HCl
C08175-01 50 mg

Amiodarone HCl

Sign In for Pricing
View Details