What is the catalog number for Recombinant human Histone H2B type 1-C/E/F/G/I?

The catalog number for Recombinant human Histone H2B type 1-C/E/F/G/I is OPCA00410-100UG.

What sizes are available for Recombinant human Histone H2B type 1-C/E/F/G/I?

Recombinant human Histone H2B type 1-C/E/F/G/I is available in the following size(s): 100 µg.

Is Recombinant human Histone H2B type 1-C/E/F/G/I in stock?

Recombinant human Histone H2B type 1-C/E/F/G/I is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant human Histone H2B type 1-C/E/F/G/I

Product Specifications

CAS Number

9000-83-3

Gene Name

Gene Aliases

DJ221C16.3; dJ221C16.6; dJ221C16.8; H2B histone family, member A; H2B histone family, member B; H2B histone family, member G; H2B histone family, member H; H2B histone family, member K; H2B histone family, member L; H2B.1; H2B.1A; H2B.1B; H2B.h; H2B/a; H2B/b; H2B/g; H2B/h; H2B/k; H2B/l; H2BC10; H2BC4; H2BC6; H2BC7; H2BC8; H2BFA; H2BFB; H2BFG; H2BFH; H2BFK; H2BFL; HIRA-interacting protein 2; HIRIP2; HIST1H2BC; HIST1H2BD; HIST1H2BE; HIST1H2BF; HIST1H2BG; HIST1H2BI; histone 1, H2bc; histone 1, H2bd; histone 1, H2be; histone 1, H2bf; histone 1, H2bg; histone 1, H2bi; histone cluster 1 H2B family member c; histone cluster 1 H2B family member d; histone cluster 1 H2B family member e; histone cluster 1 H2B family member f; histone cluster 1 H2B family member g; histone cluster 1 H2B family member i; histone cluster 1, H2bc; histone cluster 1, H2bd; histone cluster 1, H2be; histone cluster 1, H2bf; histone cluster 1, H2bg; histone cluster 1, H2bi; histone H2B type 1-C/E/F/G/I; histone H2B type 1-D; histone H2B.1 A; histone H2B.1 B; Histone H2B.a; histone H2B.b; Histone H2B.g; Histone H2B.h; histone H2B.k; histone H2B.l.

Gene ID

3017|8339|8343|8344|8346|8347

Reactivity

Homo sapiens|Human

Target

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Type

Protein

Source

E.coli

Sequence

PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.