Recombinant human Histone H2B type 1-C/E/F/G/I
Product Specifications
CAS Number
9000-83-3
Gene Name
H2B clustered histone 10|H2B clustered histone 4|H2B clustered histone 5|H2B clustered histone 6|H2B clustered histone 7|H2B clustered histone 8
Gene Aliases
DJ221C16.3; dJ221C16.6; dJ221C16.8; H2B histone family, member A; H2B histone family, member B; H2B histone family, member G; H2B histone family, member H; H2B histone family, member K; H2B histone family, member L; H2B.1; H2B.1A; H2B.1B; H2B.h; H2B/a; H2B/b; H2B/g; H2B/h; H2B/k; H2B/l; H2BC10; H2BC4; H2BC6; H2BC7; H2BC8; H2BFA; H2BFB; H2BFG; H2BFH; H2BFK; H2BFL; HIRA-interacting protein 2; HIRIP2; HIST1H2BC; HIST1H2BD; HIST1H2BE; HIST1H2BF; HIST1H2BG; HIST1H2BI; histone 1, H2bc; histone 1, H2bd; histone 1, H2be; histone 1, H2bf; histone 1, H2bg; histone 1, H2bi; histone cluster 1 H2B family member c; histone cluster 1 H2B family member d; histone cluster 1 H2B family member e; histone cluster 1 H2B family member f; histone cluster 1 H2B family member g; histone cluster 1 H2B family member i; histone cluster 1, H2bc; histone cluster 1, H2bd; histone cluster 1, H2be; histone cluster 1, H2bf; histone cluster 1, H2bg; histone cluster 1, H2bi; histone H2B type 1-C/E/F/G/I; histone H2B type 1-D; histone H2B.1 A; histone H2B.1 B; Histone H2B.a; histone H2B.b; Histone H2B.g; Histone H2B.h; histone H2B.k; histone H2B.l.
Gene ID
3017|8339|8343|8344|8346|8347
Reactivity
Homo sapiens|Human
Target
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Type
Protein
Source
E.coli
Sequence
PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Assay Protocol
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions
Reconstitution & Storage Instructions
Western Blotting/Immunoblotting (WB/IB) Protocol
Western Blotting/Immunoblotting (WB/IB) Protocol
Immunohistochemistry (IHC) Protocol
Immunohistochemistry (IHC) Protocol
Immunocytochemistry (ICC) Protocol
Immunocytochemistry (ICC) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
Blocking Peptide Competition Protocol (BPCP)
Blocking Peptide Competition Protocol (BPCP)
Immunoprecipitation (IP) Protocol
Immunoprecipitation (IP) Protocol
Antibody Array (AA) Protocol
Antibody Array (AA) Protocol
Format
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
-20°C or -80°C
Molecular Weight
40.6 kDa
Protein Length
Recombinant
NCBI Gene Symbol
H2BC10|H2BC4|H2BC5|H2BC6|H2BC7|H2BC8
Protein Name
Histone H2B type 1-C/E/F/G/I
Gene Name URL
H2BC10|H2BC4|H2BC5|H2BC6|H2BC7|H2BC8
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog