Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Histone H2B type 1-C/E/F/G/I

Product Specifications

CAS Number

9000-83-3

Gene Name

H2B clustered histone 10|H2B clustered histone 4|H2B clustered histone 5|H2B clustered histone 6|H2B clustered histone 7|H2B clustered histone 8

Gene Aliases

DJ221C16.3; dJ221C16.6; dJ221C16.8; H2B histone family, member A; H2B histone family, member B; H2B histone family, member G; H2B histone family, member H; H2B histone family, member K; H2B histone family, member L; H2B.1; H2B.1A; H2B.1B; H2B.h; H2B/a; H2B/b; H2B/g; H2B/h; H2B/k; H2B/l; H2BC10; H2BC4; H2BC6; H2BC7; H2BC8; H2BFA; H2BFB; H2BFG; H2BFH; H2BFK; H2BFL; HIRA-interacting protein 2; HIRIP2; HIST1H2BC; HIST1H2BD; HIST1H2BE; HIST1H2BF; HIST1H2BG; HIST1H2BI; histone 1, H2bc; histone 1, H2bd; histone 1, H2be; histone 1, H2bf; histone 1, H2bg; histone 1, H2bi; histone cluster 1 H2B family member c; histone cluster 1 H2B family member d; histone cluster 1 H2B family member e; histone cluster 1 H2B family member f; histone cluster 1 H2B family member g; histone cluster 1 H2B family member i; histone cluster 1, H2bc; histone cluster 1, H2bd; histone cluster 1, H2be; histone cluster 1, H2bf; histone cluster 1, H2bg; histone cluster 1, H2bi; histone H2B type 1-C/E/F/G/I; histone H2B type 1-D; histone H2B.1 A; histone H2B.1 B; Histone H2B.a; histone H2B.b; Histone H2B.g; Histone H2B.h; histone H2B.k; histone H2B.l.

Gene ID

3017|8339|8343|8344|8346|8347

Reactivity

Homo sapiens|Human

Target

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Type

Protein

Source

E.coli

Sequence

PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

H2BC10|H2BC4|H2BC5|H2BC6|H2BC7|H2BC8

Protein Name

Histone H2B type 1-C/E/F/G/I

Gene Name URL

H2BC10|H2BC4|H2BC5|H2BC6|H2BC7|H2BC8

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase 2 (CASP 2) Mouse ELISA Kit
C1734 96 Tests

Caspase 2 (CASP 2) Mouse ELISA Kit

Sign In for Pricing
View Details
Mouse Nek9 Antibody (Center) Blocking Peptide
MBS9220797-01 0.5 mg

Mouse Nek9 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
Mouse Nek9 Antibody (Center) Blocking Peptide
MBS9220797-02 5x 0.5 mg

Mouse Nek9 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
Ehd2 (NM_153068) Mouse Tagged ORF Clone Lentiviral Particle
MR220542L4V 200 µL

Ehd2 (NM_153068) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MMP-7 Antibody
MBS9409565-01 0.05 mL

MMP-7 Antibody

Sign In for Pricing
View Details
MMP-7 Antibody
MBS9409565-02 0.1 mL

MMP-7 Antibody

Sign In for Pricing
View Details