Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Proteasome subunit beta type-1

Product Specifications

CAS Number

9000-83-3

Gene Name

Proteasome 20S subunit beta 1

Gene Aliases

HC5; macropain subunit C5; multicatalytic endopeptidase complex subunit C5; PMSB1; proteasome (prosome, macropain) subunit, beta type, 1; proteasome beta 1 subunit; proteasome component C5; proteasome gamma chain; proteasome subunit beta 1; proteasome subunit beta type-1; proteasome subunit beta6; proteasome subunit HC5; PSC5; testicular secretory protein Li 45.

Gene ID

5689

Reactivity

Homo sapiens|Human

Target

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex) .

Type

Protein

Source

E.coli

Sequence

RFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

50.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PSMB1

Protein Name

Proteasome subunit beta type-1

Gene Name URL

PSMB1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OKRC01283-96W - PLGF-2 ELISA Kit (Mouse)
OKRC01283-96W 96 Well

OKRC01283-96W - PLGF-2 ELISA Kit (Mouse)

Sign In for Pricing
View Details
Lentiviral human ASAH1 shRNA (UAS) - Lentiviral human ASAH1 shRNA (UAS) (100)
GTR15316413 1 Vial

Lentiviral human ASAH1 shRNA (UAS) - Lentiviral human ASAH1 shRNA (UAS) (100)

Sign In for Pricing
View Details
OR2AF1P Adenovirus (Human)
35039051 1.0 mL

OR2AF1P Adenovirus (Human)

Sign In for Pricing
View Details
Olr1177 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7202404 1.0 µg DNA

Olr1177 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
SLC22A3 Rabbit Polyclonal Antibody (BF594)
orb2465390 100 µL

SLC22A3 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Anti-MSLN antibody
STJ27944 100 µl

Anti-MSLN antibody

Sign In for Pricing
View Details