Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LDHB Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Lactate dehydrogenase B

Gene Aliases

Epididymis secretory protein Li 281; HEL-S-281; lactate dehydrogenase H chain; LDH heart subunit; LDH-B; LDHBD; LDH-H; L-lactate dehydrogenase B chain; renal carcinoma antigen NY-REN-46; testicular secretory protein Li 25; TRG-5.

Gene ID

3945

Reactivity

Homo sapiens|Human

Target

Recombinant human L-lactate dehydrogenase B chain

Type

Protein

Source

E.coli

Sequence

ATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LDHB

Protein Name

L-lactate dehydrogenase B chain

Gene Name URL

LDHB

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WAY 316606
A3932-10 10 mg

WAY 316606

Sign In for Pricing
View Details
CCDC114 (C-1) : m-IgG Fc BP-HRP Bundle
sc-527803 1 Kit

CCDC114 (C-1) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Recombinant Human SHPK (C-6His)
CI92-01 10 µg

Recombinant Human SHPK (C-6His)

Sign In for Pricing
View Details
Recombinant Human SHPK (C-6His)
CI92-02 50 µg

Recombinant Human SHPK (C-6His)

Sign In for Pricing
View Details
Recombinant Human SHPK (C-6His)
CI92-03 500 µg

Recombinant Human SHPK (C-6His)

Sign In for Pricing
View Details
Recombinant Human SHPK (C-6His)
CI92-04 1 mg

Recombinant Human SHPK (C-6His)

Sign In for Pricing
View Details