Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Proteasome subunit beta type-7

Product Specifications

CAS Number

9000-83-3

Gene Name

Proteasome 20S subunit beta 7

Gene Aliases

Epididymis secretory sperm binding protein; macropain chain Z; multicatalytic endopeptidase complex chain Z; proteasome (prosome, macropain) subunit, beta type, 7; proteasome catalytic subunit 2; proteasome subunit alpha; proteasome subunit beta 7; proteasome subunit beta type-7; proteasome subunit beta2; proteasome subunit Z; protein serine kinase c17; Z.

Gene ID

5695

Reactivity

Homo sapiens|Human

Target

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex) . Within the 20S core complex, PSMB7 displays a trypsin-like activity.

Type

Protein

Source

E.coli

Sequence

TTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

52.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PSMB7

Protein Name

Proteasome subunit beta type-7

Gene Name URL

PSMB7

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFX2, CT (RFX2, DNA-binding protein RFX2, Regulatory factor X 2) (MaxLight 405)
MBS6341537-01 0.1 mL

RFX2, CT (RFX2, DNA-binding protein RFX2, Regulatory factor X 2) (MaxLight 405)

Sign In for Pricing
View Details
RFX2, CT (RFX2, DNA-binding protein RFX2, Regulatory factor X 2) (MaxLight 405)
MBS6341537-02 5x 0.1 mL

RFX2, CT (RFX2, DNA-binding protein RFX2, Regulatory factor X 2) (MaxLight 405)

Sign In for Pricing
View Details
SELK (SELENOK) Human Gene Knockout Kit (CRISPR)
KN403754 1 Kit

SELK (SELENOK) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Chicken Vitamin B ELISA Kit
MBS7265680-01 48 Well

Chicken Vitamin B ELISA Kit

Sign In for Pricing
View Details
Chicken Vitamin B ELISA Kit
MBS7265680-02 96 Well

Chicken Vitamin B ELISA Kit

Sign In for Pricing
View Details
Chicken Vitamin B ELISA Kit
MBS7265680-03 5x 96 Well

Chicken Vitamin B ELISA Kit

Sign In for Pricing
View Details