Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Spermidine synthase

Product Specifications

CAS Number

9000-83-3

Gene Name

Spermidine synthase

Gene Aliases

PAPT; putrescine aminopropyltransferase; SPDSY; spermidine synthase; spermidine synthase-1; SPS1; SRML1.

Gene ID

6723

Reactivity

Homo sapiens|Human

Target

Catalyzes the production of spermidine from putrescine and decarboxylated S-adenosylmethionine (dcSAM) . Has a strong preference for putrescine as substrate, and has very low activity towards 1,3-diaminopropane. Has extremely low activity towards spermidine.

Type

Protein

Source

E.coli

Sequence

REGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALNDVS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

59.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SRM

Protein Name

Spermidine synthase

Gene Name URL

SRM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PRMT6 Mouse mAb
MBS476622-01 0.1 mL

Anti-PRMT6 Mouse mAb

Sign In for Pricing
View Details
Anti-PRMT6 Mouse mAb
MBS476622-02 5x 0.1 mL

Anti-PRMT6 Mouse mAb

Sign In for Pricing
View Details
TIP30 Rabbit pAb, AE conjugated
orb2848280 100 µL

TIP30 Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
ZFP30 Lentiviral Activation Particles (h)
sc-411613-LAC 200 µL

ZFP30 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
PELO Polyclonal Antibody
A60230-020 20 µL

PELO Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Escherichia coli Zinc transport protein ZntB (zntB)
orb2926401-01 20 µg

Recombinant Escherichia coli Zinc transport protein ZntB (zntB)

Sign In for Pricing
View Details