Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Spermidine synthase

Product Specifications

CAS Number

9000-83-3

Gene Name

Spermidine synthase

Gene Aliases

PAPT; putrescine aminopropyltransferase; SPDSY; spermidine synthase; spermidine synthase-1; SPS1; SRML1.

Gene ID

6723

Reactivity

Homo sapiens|Human

Target

Catalyzes the production of spermidine from putrescine and decarboxylated S-adenosylmethionine (dcSAM) . Has a strong preference for putrescine as substrate, and has very low activity towards 1,3-diaminopropane. Has extremely low activity towards spermidine.

Type

Protein

Source

E.coli

Sequence

REGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALNDVS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

59.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SRM

Protein Name

Spermidine synthase

Gene Name URL

SRM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IgG4 (S228P) Isotype Control Antibody
YR1025-01 2 mg

Recombinant Human IgG4 (S228P) Isotype Control Antibody

Sign In for Pricing
View Details
Recombinant Human IgG4 (S228P) Isotype Control Antibody
YR1025-02 10 mg

Recombinant Human IgG4 (S228P) Isotype Control Antibody

Sign In for Pricing
View Details
Recombinant Human IgG4 (S228P) Isotype Control Antibody
YR1025-03 100 mg

Recombinant Human IgG4 (S228P) Isotype Control Antibody

Sign In for Pricing
View Details
D-Arabinose diethyldithioacetal
292254-01 1 g

D-Arabinose diethyldithioacetal

Sign In for Pricing
View Details
D-Arabinose diethyldithioacetal
292254-02 5 g

D-Arabinose diethyldithioacetal

Sign In for Pricing
View Details
D-Arabinose diethyldithioacetal
292254-03 10 g

D-Arabinose diethyldithioacetal

Sign In for Pricing
View Details