Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPMT Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Thiopurine S-methyltransferase

Gene Aliases

S-adenosyl-L-methionine:thiopurine S-methyltransferase; Thiopurine methyltransferase; thiopurine S-methyltransferase; TPMTD.

Gene ID

7172

Reactivity

Homo sapiens|Human

Target

Catalyzes the S-methylation of thiopurine drugs such as 6-mercaptopurine (also called mercaptopurine, 6-MP or its brand name Purinethol) and 6-thioguanine (also called tioguanine or 6-TG) using S-adenosyl-L-methionine as the methyl donor (PubMed:657528, PubMed:18484748) . TPMT activity modulates the cytotoxic effects of thiopurine prodrugs. A natural substrate for this enzyme has yet to be identified.

Type

Protein

Source

E.coli

Sequence

TRTSLDIEEYSDTEVQKNQVLTLEEWQDKWVNGKTAFHQEQGHQLLKKHLDTFLKGKSGLRVFFPLCGKAVEMKWFADRGHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKVFKSSSGNISLYCCSIFDLPRTNIGKFDMIWDRGALVAINPGDRKCYADTMFSLLGKKFQYLLCVLSYDPTKHPGPPFYVPHAEIERLFGKICNIRCLEKVDAFEERHKSWGIDCLFEKLYLLTE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

54.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TPMT

Protein Name

Thiopurine S-methyltransferase

Gene Name URL

TPMT

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Sgk2 3'UTR Lenti-reporter-Luc Vector
43629084 1.0 µg

Sgk2 3'UTR Lenti-reporter-Luc Vector

Ask
View Details
Water, DEPC treated
IBS-BW004a-1 50x 1 mL

Water, DEPC treated

Ask
View Details
Rabbit Anti-Human TERT monoclonal antibody, clone KG1697
CABT-L867 100 ul

Rabbit Anti-Human TERT monoclonal antibody, clone KG1697

Ask
View Details
Connexin 43 (Gap junction alpha-1 Protein, Connexin-43, Connexin 43, Connexin43, Cx43, Cx-43, Gap junction 43kD heart Protein, GJA1, GJAL) discontinued
221819-01 50 µL

Connexin 43 (Gap junction alpha-1 Protein, Connexin-43, Connexin 43, Connexin43, Cx43, Cx-43, Gap junction 43kD heart Protein, GJA1, GJAL) discontinued

Ask
View Details
Connexin 43 (Gap junction alpha-1 Protein, Connexin-43, Connexin 43, Connexin43, Cx43, Cx-43, Gap junction 43kD heart Protein, GJA1, GJAL) discontinued
221819-02 100 µL

Connexin 43 (Gap junction alpha-1 Protein, Connexin-43, Connexin 43, Connexin43, Cx43, Cx-43, Gap junction 43kD heart Protein, GJA1, GJAL) discontinued

Ask
View Details
HAND2 (Heart- and Neural Crest Derivatives-expressed Protein 2, Class A Basic Helix-loop-helix Protein 26, bHLHa26, Deciduum, Heart, Autonomic Nervous System and Neural Crest Derivatives-expressed Protein 2, dHAND, BHLHA26, DHAND, FLJ16260, MGC125303, MGC125304) (MaxLight 405) discontinued
127717-ML405 100 µL

HAND2 (Heart- and Neural Crest Derivatives-expressed Protein 2, Class A Basic Helix-loop-helix Protein 26, bHLHa26, Deciduum, Heart, Autonomic Nervous System and Neural Crest Derivatives-expressed Protein 2, dHAND, BHLHA26, DHAND, FLJ16260, MGC125303, MGC125304) (MaxLight 405) discontinued

Ask
View Details