What is the catalog number for LDHA Recombinant Protein (Human)?

The catalog number for LDHA Recombinant Protein (Human) is OPCA00313-1MG.

What sizes are available for LDHA Recombinant Protein (Human)?

LDHA Recombinant Protein (Human) is available in the following size(s): 1 mg.

Is LDHA Recombinant Protein (Human) in stock?

LDHA Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

LDHA Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Lactate dehydrogenase A

Gene Aliases

Cell proliferation-inducing gene 19 protein; epididymis secretory sperm binding protein Li 133P; GSD11; HEL-S-133P; lactate dehydrogenase M; LDH muscle subunit; LDH-A; LDHM; LDH-M; L-lactate dehydrogenase A chain; PIG19; proliferation-inducing gene 19; renal carcinoma antigen NY-REN-59.

Gene ID

3939

Reactivity

Homo sapiens|Human

Target

Recombinant human L-lactate dehydrogenase A chain

Type

Protein

Source

E.coli

Sequence

KDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.