Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Mitochondrial import inner membrane translocase subunit TIM16

Product Specifications

CAS Number

9000-83-3

Gene Name

Presequence translocase associated motor 16

Gene Aliases

CGI-136; MAGMAS; magmas-like protein; mitochondria associated protein involved in granulocyte macrophage colony stimulating factor signal transduction; mitochondria-associated granulocyte macrophage CSF-signaling molecule; mitochondrial import inner membrane translocase subunit TIM16; presequence translocase associated motor 16 homolog; Presequence translocated-associated motor subunit PAM16; SMDMDM; TIM16; TIMM16.

Gene ID

51025

Reactivity

Homo sapiens|Human

Target

Regulates ATP-dependent protein translocation into the mitochondrial matrix. Inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity.

Type

Protein

Source

E.coli

Sequence

MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PAM16

Protein Name

Mitochondrial import inner membrane translocase subunit TIM16

Gene Name URL

PAM16

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL
BNC940040-500 1x 500 µL

CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2418), CF405S conjugate, 0.1mg/mL
BNC042418-500 1x 500 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2418), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL
BNC051037-100 1x 100 µL

CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), 1mg/mL
BNUM1429-50 1x 50 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), 1mg/mL

Sign In for Pricing
View Details
MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), CF594 conjugate, 0.1mg/mL
BNC941860-500 1x 500 µL

MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Moesin (rMSN/492), CF594 conjugate, 0.1mg/mL
BNC942307-100 1x 100 µL

Moesin (rMSN/492), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details