Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Ly6/PLAUR domain-containing protein 6

Product Specifications

CAS Number

9000-83-3

Gene Name

LY6/PLAUR domain containing 6

Gene Aliases

Ly6/PLAUR domain-containing protein 6.

Gene ID

130574

Reactivity

Homo sapiens|Human

Target

Acts as a modulator of nicotinic acetylcholine receptors (nAChRs) function in the brain. Inhibits nicotine-induced Ca (2+) influx through nAChRs (PubMed:27344019) . Acts as a positive regulator of Wnt/beta-catenin signaling (By similarity) .

Type

Protein

Source

E.coli

Sequence

AQSRDFTVKDIIYLHPSTTPYPGGFKCFTCEKAADNYECNRWAPDIYCPRETRYCYTQHTMEVTGNSISVTKRCVPLEECLSTGCRDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMSVIVSCLWLWLGLML

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

43.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LYPD6

Protein Name

Ly6/PLAUR domain-containing protein 6

Gene Name URL

LYPD6

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hoxb4 Protein Vector (Mouse) (pPM-C-HA)
23820024 500 ng

Hoxb4 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
SRMS, CT (Tyrosine-protein Kinase Srms, C20orf148) (PE) discontinued
S6567-60A-PE 200 µL

SRMS, CT (Tyrosine-protein Kinase Srms, C20orf148) (PE) discontinued

Sign In for Pricing
View Details
Nodal Recombinant Antibody, APC-Cy5.5 Conjugated
bsm-62611R-APC-Cy5.5 100 µL

Nodal Recombinant Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
TYK2 (Ab-1054) Conjugated Antibody
orb1629367 100 µL

TYK2 (Ab-1054) Conjugated Antibody

Sign In for Pricing
View Details
Rat Znf783 Pre-designed siRNA Set A
SI216525A 1 Each

Rat Znf783 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Zinc finger protein 230 (ZNF230) Human ELISA Kit
I3384 96 Tests

Zinc finger protein 230 (ZNF230) Human ELISA Kit

Sign In for Pricing
View Details