Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Hepatocellular carcinoma-associated protein TD26

Product Specifications

CAS Number

9000-83-3

Gene Name

Angiopoietin like 8

Gene Aliases

Angiopoietin-like protein 8; Betatrophin; betatrophin variant 1; betatrophin variant 2; C19orf80; hepatocellular carcinoma-associated gene TD26; hepatocellular carcinoma-associated protein TD26; lipasin; PRO1185; PVPA599; refeeding-induced fat and liver protein; RIFL; TD26.

Gene ID

55908

Reactivity

Homo sapiens|Human

Target

Hormone that acts as a blood lipid regulator by regulating serum triglyceride levels (PubMed:22569073, PubMed:22809513, PubMed:23150577) . May be involved in the metabolic transition between fasting and refeeding: required to direct fatty acids to adipose tissue for storage in the fed state (By similarity) .

Type

Protein

Source

E.coli

Sequence

APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

23.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ANGPTL8

Protein Name

Angiopoietin-like protein 8

Gene Name URL

ANGPTL8

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gga2 Mouse shRNA Plasmid (Locus ID 74105)
TL504901 1 Kit

Gga2 Mouse shRNA Plasmid (Locus ID 74105)

Sign In for Pricing
View Details
PSMAL, ID (FOLH1B, PSMAL, Putative N-acetylated-alpha-linked acidic dipeptidase, Cell growth-inhibiting gene 26 protein, Prostate-specific membrane antigen-like protein, Putative folate hydrolase 1B) (MaxLight 650)
MBS6338169-01 0.1 mL

PSMAL, ID (FOLH1B, PSMAL, Putative N-acetylated-alpha-linked acidic dipeptidase, Cell growth-inhibiting gene 26 protein, Prostate-specific membrane antigen-like protein, Putative folate hydrolase 1B) (MaxLight 650)

Sign In for Pricing
View Details
PSMAL, ID (FOLH1B, PSMAL, Putative N-acetylated-alpha-linked acidic dipeptidase, Cell growth-inhibiting gene 26 protein, Prostate-specific membrane antigen-like protein, Putative folate hydrolase 1B) (MaxLight 650)
MBS6338169-02 5x 0.1 mL

PSMAL, ID (FOLH1B, PSMAL, Putative N-acetylated-alpha-linked acidic dipeptidase, Cell growth-inhibiting gene 26 protein, Prostate-specific membrane antigen-like protein, Putative folate hydrolase 1B) (MaxLight 650)

Sign In for Pricing
View Details
PLOD2 Polyclonal Antibody
MBS8531739-01 0.1 mg

PLOD2 Polyclonal Antibody

Sign In for Pricing
View Details
PLOD2 Polyclonal Antibody
MBS8531739-02 0.1 mL (AF635)

PLOD2 Polyclonal Antibody

Sign In for Pricing
View Details
PLOD2 Polyclonal Antibody
MBS8531739-03 0.1 mL (AF610)

PLOD2 Polyclonal Antibody

Sign In for Pricing
View Details