What is the catalog number for Recombinant human Luc7-like protein 3?

The catalog number for Recombinant human Luc7-like protein 3 is OPCA00285-100UG.

What sizes are available for Recombinant human Luc7-like protein 3?

Recombinant human Luc7-like protein 3 is available in the following size(s): 100 µg.

Is Recombinant human Luc7-like protein 3 in stock?

Recombinant human Luc7-like protein 3 is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant human Luc7-like protein 3

Product Specifications

CAS Number

9000-83-3

Gene Name

LUC7 like 3 pre-mRNA splicing factor

Gene Aliases

CAMP regulatory element-associated protein 1; cisplatin resistance-associated-overexpressed protein; CRA; CREAP-1; CRE-associated protein 1; CROP; hLuc7A; LUC7A; LUC7-like 3; luc7-like protein 3; OA48-18; okadaic acid-inducible phosphoprotein OA48-18.

Gene ID

51747

Reactivity

Homo sapiens|Human

Target

Binds cAMP regulatory element DNA sequence. May play a role in RNA splicing.

Type

Protein

Source

E.coli

Sequence

MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKV

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.