Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Luc7-like protein 3

Product Specifications

CAS Number

9000-83-3

Gene Name

LUC7 like 3 pre-mRNA splicing factor

Gene Aliases

CAMP regulatory element-associated protein 1; cisplatin resistance-associated-overexpressed protein; CRA; CREAP-1; CRE-associated protein 1; CROP; hLuc7A; LUC7A; LUC7-like 3; luc7-like protein 3; OA48-18; okadaic acid-inducible phosphoprotein OA48-18.

Gene ID

51747

Reactivity

Homo sapiens|Human

Target

Binds cAMP regulatory element DNA sequence. May play a role in RNA splicing.

Type

Protein

Source

E.coli

Sequence

MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKV

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

13.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LUC7L3

Protein Name

Luc7-like protein 3

Gene Name URL

LUC7L3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 Spike Glycoprotein Antibody
abx461660-01 100 µg

SARS-CoV-2 Spike Glycoprotein Antibody

Sign In for Pricing
View Details
SARS-CoV-2 Spike Glycoprotein Antibody
abx461660-02 1 mg

SARS-CoV-2 Spike Glycoprotein Antibody

Sign In for Pricing
View Details
CA 15-3, Human Breast Adenocarcinoma
P1435-5 5 KU

CA 15-3, Human Breast Adenocarcinoma

Sign In for Pricing
View Details
Canine Proteasome subunit beta type-8 (PSMB8) ELISA Kit
MBS7216435-01 48 Well

Canine Proteasome subunit beta type-8 (PSMB8) ELISA Kit

Sign In for Pricing
View Details
Canine Proteasome subunit beta type-8 (PSMB8) ELISA Kit
MBS7216435-02 96 Well

Canine Proteasome subunit beta type-8 (PSMB8) ELISA Kit

Sign In for Pricing
View Details
Canine Proteasome subunit beta type-8 (PSMB8) ELISA Kit
MBS7216435-03 5x 96 Well

Canine Proteasome subunit beta type-8 (PSMB8) ELISA Kit

Sign In for Pricing
View Details