Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Hemoglobin subunit beta-2

Product Specifications

CAS Number

9000-83-3

Gene Name

Hemoglobin, beta adult minor chain

Gene Aliases

AI036344; beta min; beta minor globin; beta2; Beta-2-globin; Hbb2; Hbbt2; Hemoglobin beta-2 chain; Hemoglobin beta-minor chain; hemoglobin subunit beta-2.

Gene ID

15130

Reactivity

Mouse|Mus musculus

Target

Involved in oxygen transport from the lung to the various peripheral tissues.

Type

Protein

Source

E.coli

Sequence

VHLTDAEKSAVSCLWAKVNPDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKKVITAFNEGLKNLDNLKGTFASLSELHCDKLHVDPENFRLLGNAIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHKYH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

42.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Hbb-b2

Protein Name

Hemoglobin subunit beta-2

Gene Name URL

Hbb-b2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr443 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
34410116 3x 1.0 µg

Olr443 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
(1S,8R, z) -8-Amino-cyclooct-4-enecarboxylic acid
sc-287430 100 mg

(1S,8R, z) -8-Amino-cyclooct-4-enecarboxylic acid

Sign In for Pricing
View Details
Anti-GIGYF1 Antibody Picoband®, iFluor647 Conjugate
A14236-iFluor647 100 µg

Anti-GIGYF1 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
DYNLL2 Rabbit pAb
A13888-01 20 µL

DYNLL2 Rabbit pAb

Sign In for Pricing
View Details
DYNLL2 Rabbit pAb
A13888-02 100 μL

DYNLL2 Rabbit pAb

Sign In for Pricing
View Details
DYNLL2 Rabbit pAb
A13888-03 500 μL

DYNLL2 Rabbit pAb

Sign In for Pricing
View Details