Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Carboxylesterase 1C

Product Specifications

CAS Number

9000-83-3

Gene Name

Carboxylesterase 1C

Gene Aliases

Carboxylesterase 1C; Ces; Ces-N; Ee1; Ee-1; Es; Es-; Es1; Es4; Es-4; EsN; Es-N; esterase 1; liver carboxylesterase N; lung surfactant convertase; PESN; PES-N.

Gene ID

13884

Reactivity

Mouse|Mus musculus

Target

Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the extracellular metabolism of lung surfactant.

Type

Protein

Source

E.coli

Sequence

HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPPETDPTEH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

85.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Ces1c

Protein Name

Carboxylesterase 1C

Gene Name URL

Ces1c

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cry1Ac Antibody
CSB-PA356448EA01BDC-01 50 µg

Cry1Ac Antibody

Sign In for Pricing
View Details
Cry1Ac Antibody
CSB-PA356448EA01BDC-02 100 µg

Cry1Ac Antibody

Sign In for Pricing
View Details
PIC 254-NSA-A2-B7527 AC Signs
809964 Card of 1 Pictogram(s)

PIC 254-NSA-A2-B7527 AC Signs

Sign In for Pricing
View Details
KRTAP19-1 CRISPR Activation Plasmid (h2)
sc-416684-ACT-2 20 µg

KRTAP19-1 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
GALNT10 Antibody
E314623 200 µL

GALNT10 Antibody

Sign In for Pricing
View Details
TFB2M Lentiviral Activation Particles (m2)
sc-420867-LAC-2 200 µL

TFB2M Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details